Q: Locate resources available on campus or in the community that provide information about drugs…
A: Drug addiction or drug abuse is the excessive usage of illegal drug or the use of prescription or…
Q: What is a clinical specimen? b. Laboratory results obtained in the clinical laboratory are only as…
A: A specimen is a sample of material or substance, usually taken from a patient's body, that is used…
Q: Which of the following would contribute to gout? O decreased nucleotidase activity Ohigh adenosine…
A: Gout is a form of Arthritis characterized by tender joints and joint pain. The symptoms of gout…
Q: What is the evolutionary history of life on Earth, and what are the major events and adaptations…
A: The history of life on Earth is a vast and complex subject that spans billions of years. Scientists…
Q: Why would extra or missing chromosomes result to abnormal phenotypes?
A: If a person is either missing a chromosome, or has an extra chromosome, the result will be a…
Q: Explain the difference in read-out between the Crystal Violet Dye Elution Assay and the Acid…
A: The Crystal Violet Dye Elution Assay (CVDEA) and the Acid Phosphatase Assay (APA) are two distinct…
Q: Nematocysts in cnidarians are O reproductive cells O excretory organs sets of muscle cells O…
A: Cnidarians are a group of invertebrate animals that include jellyfish, sea anemones, corals, and…
Q: Part I. Structure-Function Relationships in Genes 1. Consider the "two-line model" of a gene shown…
A: Note: Since you have asked multiple questions, we will solve the first question for you. If you want…
Q: Give typing answer with explanation and conclusion Scientists are trying to estimate the size of a…
A: Mark-Recapture method is used to determine the population size when it is difficult to count every…
Q: Can you please answer the following three questions (one paragraph for each question). Your answers…
A: A mutation is a change that occurs in the DNA sequence of an organism's genome. Mutations can be…
Q: Which options describes the function of Glycogen Synthase Kinase? Inhibits glycogen synthase…
A: The body uses the complex carbohydrate glycogen, which is kept in the muscles and liver, as an…
Q: Which of the following is not a characteristic of the phylum Chordata
A: The phylum Chordata is a group of animals that includes vertebrates (animals with backbones) as well…
Q: Briefly describe the role of T-helper (TH) cells in the function of the immune system. Be sure to…
A: T-helper (TH) cells are a specialized type of white blood cell that plays a critical role in the…
Q: 2. What do you predict might happen to the cells of a fish that is accustomed to living in fresh…
A: Osmosis is the movement of water molecules across a selectively permeable membrane from an area of…
Q: Explain what is meant by the Mind-Body Connection. o What would you like to include in your…
A: Each of the billions of cells that make up the human body is capable of growing, metabolizing and…
Q: Multicellular organisms have specialized cells that exist in tissues that perform unique functions…
A: Multicellular organisms are organisms that are composed of many cells, with each cell performing a…
Q: 11) A reaction occurs when water is added to separate two compounds. Dehydration b. Condensation C.…
A: When a substance do some chemical changes to produce a new substance which have entire new property,…
Q: 6) Transpiration is defined as: a. Liquid water given off by plants which evaporates into the…
A: Transpiration is an important step in the water cycle that occurs in plants. This mechanism is in…
Q: For Brown lizard Anoles What is the geographic distribution of each species? Is it native or…
A: Brown anoles (Anolis sagrei) are a species of lizard which belong to the family of Dactyloidae.…
Q: none compresive What is the sequence of the important major steps in the evolution of the animal…
A: The evolution of the animal kingdom is a complex and ongoing process that spends billions of years.…
Q: Based on pedigree analysis, which marker (A1-A4) is apparently linked with the disease allele? 111…
A: the given pedigree belongs to a family that showcase autosomal dominant disease inheritance pattern.…
Q: 1. What is diversity? 2. Differentiate between predation and herbivory. 3. List and give examples of…
A: Ecology is the study of interactions between living things, such as humans, and their natural…
Q: 1) Compounds composed of carbon, hydrogen, and oxygen collectively are known as: a. Inorganic…
A: A compound is defined as a material that is formed when two or more chemical elements are bonded…
Q: What frequencies (%s) of gametes are produced by a female Drosophila of genotype A B/ a b when the…
A: Drosophila, sometimes known as fruit flies, has been used as a model organism in genetic study for…
Q: for Harmonia axyridis, asian lady beetle What is the geographic distribution of each species? Is…
A: The harlequin, multicolored Asian, or Asian lady beetle is the most well-known name for the huge…
Q: Question 1. What recruits the enzymes that form the 7-methylguanosine 5' cap on the transcript as it…
A: Primary transcript, also known as heterogeneous nuclear RNA (hnRNA), refers to the initial RNA…
Q: 20 mM CI- Extracellular space + + 111 mM Cl- + cell 1 Vm= -90 mV
A: Here in this case, we must take into account changes in Gibbs free energy in order to estimate the…
Q: 4. During development of an antiviral drug to inhibit enteroviruses, resistant viruses are isolated,…
A: Enteroviruses are a type of virus that causes a variety of diseases in people, ranging from mild…
Q: Activated helper T Cells participate in which of the following processes? a.) Differentiation of…
A: Helper T cells or CD4+ T-cells are a type of T-cell that play an important role in the adaptive…
Q: Question 3. It is not necessary to take precautions against shearing RNA during the purification…
A: RNA molecules are more prone to shearing than DNA due to their single stranded nature & smaller…
Q: Some cancers show increased incidence with age while others peak at younger ages. Why do you suppose…
A: The Cancer is defined as a group of diseases which is characterized by the uncontrolled growth and…
Q: 54. After an inferior alveolar nerve block injection all of the following areas will be anesthetized…
A: A popular dental procedure used to numb the lower jaw and teeth for dental operations is an inferior…
Q: In a population of birds, the climate becomes colder over time. Birds with larger bodies and thicker…
A: By a process called natural selection, organisms that have characteristics that increase their…
Q: True or False: Microglia contribe to synaptic pruning
A: Microglia are a type of specialized cells that are the resident immune cells in the central nervous…
Q: please answer the following questions and also do the image attach please i would really appreciate…
A: All living forms possess some unique characteristics that make them different from each other. Based…
Q: how does administration of 100% oxygen save a patient from carbon monoxide poisioning
A: Carbon Monoxide(CO) Poisoning happens when the concentration of carbon monoxide increases in blood…
Q: Human immunodeficiency virus (HIV), the causative agent of acquired immune deficiency syndrome…
A: AIDS (Acquired Immune deficiency syndrome) is a disease that is caused by HIV (Human Immuno…
Q: Which of the following substances may start to appear in the urine when the glomerulus is inflamed?…
A: Glomerulonephritis is a condition in which the tiny filters called glomeruli in the kidneys become…
Q: Differentiate the four classes of phylum Porifera by making a phylogenetic tree (Make your own…
A: Members of Porifera are called sponges which are multicellular eukaryotes with cellular grade of…
Q: List 2 limitations and 5 interfering substances of the BinaxNOW® RSV
A: An immunoassay-based quick diagnostic test called BinaxNOW® RSV is used to identify RSV antigen in…
Q: 2.In a typical ecosystem, what percentage of the energy produced by the autotrophs then consumed by…
A: Living entities in an ecosystem are known as the biotic components, that includes plants, animals,…
Q: The number of synapses in the human cortex adulthood and from adulthood to old age. increases;…
A: Neuronal connectors called synapses enable the transfer of messages between them. These are the…
Q: Lipids form the barriers surrounding various compartments within an organism. Which property of…
A: Lipids are a diverse group of biomolecules that serve many important functions in living organisms.…
Q: What factors dictate ecological footprint? Mention three of them, that can improve ecological foot…
A: Environmental sustainability is a increasingly important issue nowadays, as we face range of…
Q: Receptors such as those in the inner ear, respond to stimulation with an AM response. In contrast, a…
A: Sensory receptors are specialized cells or structures in the body that detect and respond to…
Q: Serological reactions in virology. Neutralization test (NT), hemagglutination inhibition test (HIT).
A: Virology is a subfield of microbiology concerned with the study of viruses and their impact on…
Q: . The concentration of atmospheric carbon dioxide has increased since the beginning of the…
A: Increasing levels of atmospheric carbon dioxide (CO2) can have both positive and negative effects on…
Q: You are applying to a graduate school of public health to pursue Masters of Science in Microbiology…
A: Microbiology is the study of microorganisms, which include bacteria, viruses, fungi, protozoa, and…
Q: 16) What is true about pH? a. acids are a pH less than 7 b. bases are a pH greater than 7 c. water…
A: Acids are those substances which are sour in taste. They can donate proton ions in solution. Based…
Q: Which of the following statements is true of all enzymes? A They are soluble in water. B They have a…
A: Enzymes are biological molecules that act as catalysts to accelerate or facilitate chemical…
Can I please have help with this question,thank you!
Trending now
This is a popular solution!
Step by step
Solved in 5 steps with 4 images
- Complete the protein synthesis for the partial DNA sequence for a normal FGFR3 gene (TOP) and mutated FGFR3 gene (BOTTOM). Remember, when filling in mRNA, use capital letters only. When filling in amino acids, use three letters, with the first letter capitalized. If you do not use this format, your answer may be marked wrong. DNA CCG TTC GGG GAA ССС MRNA Amino Acid DNA CCG TTC GGG GAA TCC MRNA Amino AcidSickle cell hemoglobin DNA CACGTAGACTGAGG ACAC.. Sickle cell hemoglobin MRNA Sickle cell hemoglobin AA sequence 4. What type of mutation is this? Please explain why.The beginning of the hexose kinase gene's sequence can be found below, the +1 nucleotide is underlined and bolded. It also contains an origin of replication (ORI) which is found at position 30. 20 ORI 40 60 5'..TTCGAGCTCTCGTCGTCGAGATACGCGATGATATTACTGGTAATATGGGGATGCACTATC...3' 3'...AAGCTCGAGAGCAGCAGCTСТАТGCGCTАСТАТААTGACСАТТАТАССССТАСGTGATAG...5" promoter a. Assume that replication has been initiated at that ORI. Provide the sequence of the primer that is complementary to the DNA in each of the following positions. Site A - binding to the top strand of the DNA at position 20 – 30 5' 3' Site B - binding to the top strand of the DNA at position 31 – 41 5' 3'
- Given the sequence below, (A) What is the transcript (MRNA) sequence? (B) What is the amino acid sequence of the translated peptide? Rather than using abbreviations, write out the entire name of each of the amino acids in your peptide, so you do not risk using the wrong abbreviation and, therefore, providing the wrong sequence. 5' - ATG CTT GTA ATA CCG TGA - 3'8:52 Protein 1-10092015113603.pdf https:api.schoology.comv1attachment169963839... Name Class Date Section Protein Synthesis pages 148-153) 7-3 SECTION REVIEW In this section you studied the process of pro- tein synthesis. You learned that the informa- tion that DNA transfers to messenger RNA (MRNA) is in the form of a code. When the information is decoded, chains of amino acids, called polypeptides, are formed. Polypeptides During translation, each MRNA codon in turn make up proteins, which direct biochemical pathways and are responsible for cell structure and movement. The genetic code is determined by the arrangement of the nitrogenous bases in DNA and RNA. A code word in DNA consists of a group of three nucleotides. When transcribed into MRNA, each code word, or codon, desig- nates a specific amino acid that is to be placed in the polypeptide chain. More than one codon may code for a particular amíno acid. The MANA sequence AUG serves as an initiator, or "start," codon. Three other…The beginning of the hexose kinase gene's sequence can be found below, the +1 nucleotide is underlined and bolded. It also contains an origin of replication (ORI) which is found at position 30. 1 20 ORI 40 60 5'..TTCGAGCTCTCGTCGTCGAGATACGCGATGATATTACTGGTAATATGGGGATGCACTATC...3’ 3'...AAGCTCGAGAGCAGCAGCTСТАТGCGCTАСТАТААTGACCATTATАССССТАСGTGATAG...5' promoter 2a. Assume that replication has been initiated at that ORI. Provide the sequence of the primer that is complementary to the DNA in each of the following positions. Site A - binding to the top strand of the DNA at position 20 – 30 5' 3' Site B - binding to the top strand of the DNA at position 31 – 41 5' 3' 2b. Replication is occurring normally in these cells; would you expect to find a primer in both positions? Why or why not?
- The beginning of the hexose kinase gene's sequence can be found below, the +1 nucleotide is underlined and bolded. It also contains an origin of replication (ORI) which is found at position 30. 1 20 ORI 40 60 5'.TTCGAGCTCTCGTCGTCGAGATACGCGATGATATTACTGGTAATATGGGGATGCACTATC...3' 3'.AAGCTCGAGAGCAGCAGCTCTATGCGCTACTATAATGACCATTATACCCCTACGTGATAG...5' promoter 2a. Assume that replication has been initiated at that ORI. Provide the sequence of the primer that is complementary to the DNA in each of the following positions. d Site A - binding to the top strand of the DNA at position 20 – 30 5' 3' Site B - binding to the top strand of the DNA at position 31 -41 5' 3' 2b. Replication is occurring normally in these cells; would you expect to find a primer in both positions? Why or why not?What is the sequence of the mRNA transcript that will be produced from the following sequence of DNA? The top strand is the template strand, the bottom strand is the coding strand. 5’ – TCGGGATTAGACGCACGTTGGCATACCTCG – 3’ 3’ – AGCCCTAATCTGCGTGCAACCGTATGGAGC – 5’ Enter the mRNA sequence here (pay close attention to the direction of the molecule!): 5'-_____-3'5 5 S 6 5 5 5 6 U 6 U 6 5:14 PM | 0.2KB/s HHHHH R R U RUUR ARU AP AP R U U R R AP R R R AP MOLECULAR...GENETICS. Describe gene regulation at transcription level. Explain the role of antsense RNA in control mechanism. Describe translational control mechanisms. Describe common DNA damages. Distinguish excision and mismatch repair. Describe the role of recA protein in recombination repair Elaborate on SOS repair mechanism. Define thymine dimer. How are they formed and repaired? Describe the molecular basis of mutation. 11 Leu+ Met+ Arg+ Write a detailed note on spontaneous mutation. Explain about mutant detection methods. Define reverse mutation. Describe the mechanism underlying Intragenic and intergenic suppressor mutations Describe the transposition mechanisms. 13 Vo LTE UNIT IV Time (Min) Describe the process of generalised transformation occurring in bacterial chromosome and plasmid. Elaborate on molecular mechanism and significance of transformation 22 Describe the process of…
- A sample of liver cells was collected from a healthy donor and from an individual with liver cancer. mRNA was isolated from both samples of cells and subjected to DNA microarray analysis. In the results from the two samples, 77 spots on the microarray from the cancer cells were much brightercompared to those for the cells from the healthy donor. How wouldyou interpret these results? Explain their meaning with regard to thegrowth of the cancer cells. (Note: Assume that each spot correspondsto a different gene.)O File C:/Users/Admin/Downloads/cbcc9-guided-reading-ch11.pdf o Sign Off o Outlook O New Tab eE broccoli 0/0 2国《 reading-ch11.pdf 會 %00L 14. Complete the following table, which compares late-stage gene regulation mechanisms. MRNA breakdown Initiation of translation Protein processing Description ExampleThe code for a fully functional protein is actually coming from an mRNA transcript that has undergone post transcriptional processing which is essentially way too different from the original code in the DNA template. Given: Cytosine; a Protein with known amino acid sequence (amino acid sequence given below) MATIVNTKLGEHRGKKRVWLEGQKLLREGYYPGMKYDLELKDSQVVLRVKEEGKFTISKRERNGRVSPII DLTVQELATVFDGVEMLRVFIRNGAIVISAHHQQERVIERVNRLISKLENGESLSVCSLFHGGGVLDKAI HAGFHKAGIASAISVAVEMEGKYLDSSLANNPELWNEDSIVIESPIQAVNLSKRPPQVDVLMGGIPCTGA SKSGRSKNKLEFAESHEAAGAMFFNFLQFVEALNPAVVLIENVPEYQNTASMEVIRSVLSSLGYSLQERI LDGNEFGVIERRKRLCVVALSHGIDGFELEKVQPVRTKESRIQDILEPVPLDSERWKSFDYLAEKELRDK AAGKGFSRQLLTGDDEFCGTIGKDYAKCRSTEPFIVHPEQPELSRIFTPTEHCRVKGIPEELIQGLSDTI AHQILGQSVVFPAFEALALALGNSLWSWVGMMPIMVEVVDESQPVIGGEDFHWATALVDAKGTLKLSPAA KKQGMPFNIMDGQLAVYSPNGTKKSCGHEPCEYLPVMMSGDAIMVTSSLVH Requirement: Original DNA code (itemize the steps you would take to get to know the original DNA code of Cytosine in focus)